PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013634110.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 262aa    MW: 28398.7 Da    PI: 8.8386
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013634110.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.75.7e-181358147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEd+ll  +v+++G+++W++I++ +  gR++k+c++rw + 
   XP_013634110.1 13 KGPWSPEEDQLLQTLVQKHGPRNWSLISKPIS-GRSGKSCRLRWCNQ 58
                     79******************************.***********985 PP

2Myb_DNA-binding52.79.7e-1767109347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++++eEde ++ a++++G++ W+tIar ++ gRt++ +k++w++ 
   XP_013634110.1  67 AFSPEEDETILLAHARFGNK-WATIARLLN-GRTDNAIKNHWNST 109
                      79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.18863IPR017930Myb domain
SuperFamilySSF466893.38E-3110106IPR009057Homeodomain-like
SMARTSM007174.5E-151261IPR001005SANT/Myb domain
PfamPF002491.1E-171358IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.3E-251466IPR009057Homeodomain-like
CDDcd001673.80E-141557No hitNo description
SMARTSM007178.8E-1464112IPR001005SANT/Myb domain
PROSITE profilePS5129419.48865114IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.4E-2267113IPR009057Homeodomain-like
CDDcd001671.17E-1067110No hitNo description
PfamPF002492.5E-1467109IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MSGSTRKETD RIKGPWSPEE DQLLQTLVQK HGPRNWSLIS KPISGRSGKS CRLRWCNQLS  60
PEVEHRAFSP EEDETILLAH ARFGNKWATI ARLLNGRTDN AIKNHWNSTL KRKCSGGGGG  120
WTSNDGGNGG YDGSLTDEQP LKRTASGGGG GVVSTGLFMN PGSPSGSDVS EQSSGPVSHV  180
YKPKARAGGV VIESAVKDPA ISLSLSLPWV NESTQGRDTA ELFPARKQEE ERGTFSGDFM  240
KVVQEMIKTE VRSYMAELQL GI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-41121143105MYB PROTO-ONCOGENE PROTEIN
1h88_C2e-401211457159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-401211457159MYB PROTO-ONCOGENE PROTEIN
1mse_C3e-41121143105C-Myb DNA-Binding Domain
1msf_C3e-41121143105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013634110.10.0PREDICTED: transcription factor MYB44
SwissprotQ9FDW12e-91MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A0D3C1F10.0A0A0D3C1F1_BRAOL; Uncharacterized protein
STRINGBra032176.1-P1e-168(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM67728135
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23290.11e-111myb domain protein 70